Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant TM2 domain-containing protein Y66D12A.21 (Y66D12A.21)

This Recombinant TM2 domain-containing protein Y66D12A.21 (Y66D12A.21) spans the amino acid sequence from region 19-329.

Product Specifications

Product Name Alternative

TM2 domain-containing protein Y66D12A.21

UniProt

Q95PJ8

Expression Region

19-329

Origin

Caenorhabditis elegans

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TVKCDDLDPNQYLCKNYAVDTITQQSVTCAADNSIQVMCETAEHIKCVGKDQFGIFNRTV PSACHYGAHVSYTTTVLLSIFLGFFGIDRIYLGYYALGLIKMFSLGGLFVFWLVDIILIS LQLLGPADGTAYAMAYYGPKAQMIRLVATIWKKNWKILEIIVEKKMKISEKLNKNDFYVE NSRKLYIFSGKFEFSVTKSSKIEFLGEKLNKKDFLNENCKKLNKNDLYVENSRRLYIFSG KFEFSVPKSSRKISIFLFFFRRKSKNREKKLKNHRKSIEIHFFFQKFFQIFIFFTFDSHT NFSFYTCDGCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-500 1x 500 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (B2M/961), CF647 conjugate, 0.1mg/mL
BNC470961-100 1x 100 µL

Beta-2 Microglobulin (B2M) (B2M/961), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-intact (HCGab/52), CF594 conjugate, 0.1mg/mL
BNC940052-500 1x 500 µL

HCG-intact (HCGab/52), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/992), CF647 conjugate, 0.1mg/mL
BNC470992-100 1x 100 µL

SOX10 (SOX10/992), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details