Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q8ZAU9

Expression Region

1-311

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTE VPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALS QEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGA TAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSA DSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPM TKLMHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGKV1OR-3 3'UTR Luciferase Stable Cell Line
TU010811 1.0 mL

IGKV1OR-3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rent3a (h) -PR
sc-38227-PR 10 µM - 20 µL

Rent3a (h) -PR

Sign In for Pricing
View Details
Anti-S Antibody-FITC (9P501)
TMAH-01061F-01 50 μL

Anti-S Antibody-FITC (9P501)

Sign In for Pricing
View Details
Anti-S Antibody-FITC (9P501)
TMAH-01061F-02 100 µL

Anti-S Antibody-FITC (9P501)

Sign In for Pricing
View Details
PTPRN Polyclonal Antibody
MBS2522978-01 0.02 mL

PTPRN Polyclonal Antibody

Sign In for Pricing
View Details
PTPRN Polyclonal Antibody
MBS2522978-02 0.06 mL

PTPRN Polyclonal Antibody

Sign In for Pricing
View Details