Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q8ZAU9

Expression Region

1-311

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTE VPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALS QEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGA TAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSA DSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPM TKLMHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FKRP Rabbit pAb
GB111929-100 100 μL

Anti-FKRP Rabbit pAb

Sign In for Pricing
View Details
Mouse Multidrug resistance-associated protein 9, ABCC12 ELISA Kit
MBS9333093-01 48 Well

Mouse Multidrug resistance-associated protein 9, ABCC12 ELISA Kit

Sign In for Pricing
View Details
Mouse Multidrug resistance-associated protein 9, ABCC12 ELISA Kit
MBS9333093-02 96 Well

Mouse Multidrug resistance-associated protein 9, ABCC12 ELISA Kit

Sign In for Pricing
View Details
Mouse Multidrug resistance-associated protein 9, ABCC12 ELISA Kit
MBS9333093-03 5x 96 Well

Mouse Multidrug resistance-associated protein 9, ABCC12 ELISA Kit

Sign In for Pricing
View Details
Mouse Multidrug resistance-associated protein 9, ABCC12 ELISA Kit
MBS9333093-04 10x 96 Well

Mouse Multidrug resistance-associated protein 9, ABCC12 ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat Homeodomain-interacting protein kinase 3 (Hipk3) , partial
MBS1154214 Inquire

Recombinant Rat Homeodomain-interacting protein kinase 3 (Hipk3) , partial

Sign In for Pricing
View Details