Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable cytochrome c oxidase subunit 2 (ctaC)

This Recombinant Probable cytochrome c oxidase subunit 2 (ctaC) spans the amino acid sequence from region 43-353.

Product Specifications

Product Name Alternative

Probable cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome aa3 subunit 2, Cytochrome c oxidase polypeptide II

UniProt

Q9CCF1

Expression Region

43-353

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DALAIGWPEGITPEAHLNRQLWIGAVVASLVVGVIVWGLIFWSTIFHRKKTTDTELPRQF GYNMPLELVLTVTPFLIISMLFYFTVIVQDKMLYLAKDPEVVIDVTAFQWNWKFGYQRVD FKDGTLTYDGVDPARKKAMVSKPEGKDSHGEELVGAVRGLNTEDRAYLNFDKVETLGTTT EIPVLVLPAGKRIEFQLNSADVVHSFWVPKFLFKRDVMPNPVANNSVNVFQVEEITKTGA FVGHCAEMCGTYHSMMNFEVRVVAPNDFKAYLQQRIDGKTNAEALQVIAQPPLAVTTHPF DTRRGQLTNSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF568 conjugate, 0.1mg/mL
BNC682166-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF568 conjugate, 0.1mg/mL
BNC682958-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details