Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leptosira terrestris Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Leptosira terrestris Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A6YG74

Expression Region

1-312

Origin

Leptosira terrestris (Filamentous green alga) (Pleurastrum terrestre)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAEIVVNNSNFSSNTPPFLKKQPEIRRYIIQGSRRFSNYWWAFIVCLGSIGFLLTGISS YFEFQNLLHLQNYFSFANEAQSSLNKVELPIILFFPQGLVMCFYGILGLFLSFYLWFSIF LNIGAGFNEIYIYTGETLKTENQYSKSINSNNLKANNWNSSKIKSNLKKFTKMKDTQTID YSSENELKNQLTNPNSAVCKFAKGGSEVGCWEQSALTPLPPTPLSHIRIFRWGFPGKNRK INLQYSIDQISAIKLEFLQGFNSKRTICLKLSDQREILLTGSPQGDWETFEQLEKQASEL AKFLKVNLEFSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-100 1x 100 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-500 1x 500 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details