Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Metaxin-1 homolog (mtx-1)

This Recombinant Metaxin-1 homolog (mtx-1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Metaxin-1 homolog, Mitochondrial outer membrane import complex protein 1

UniProt

O45503

Expression Region

1-312

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELHIWPSDFGLPTIDVVSLQFLACSKMCASPVRVIQSTRPWRSPSGELPMVAQTEGEAK PVTDFEKFVDILKKCGQDVVIDADLTTIEKAQLDAFSCYLHHNLYPAVMHTFWTDELNYN TVTQYWYASHLHFPYNLYYLEKRRKKALRLLAGKNDTEILKEAFMALNTLSTKLGDNKFF CGNKPTSLDALVFGYLAPLLRVPLPNDRLQVQLSACPNLVRFVETVSSIYLPLGEDELKR QQANRKMWQSRISKAKADKEAAKTTEEASESLPEEPPMRDAILFTLGALTLSLVFAIHTG LIQVSVEEEISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-100 1x 100 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details