Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Plasma membrane-associated coenzyme Q6 reductase PGA3 (PGA3)

This Recombinant Saccharomyces cerevisiae Plasma membrane-associated coenzyme Q6 reductase PGA3 (PGA3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Plasma membrane-associated coenzyme Q6 reductase PGA3, EC= 1.6.-.-, Processing of GAS1 and ALP protein 3

UniProt

Q12746

Expression Region

1-312

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKEDIEGTNILDEPVHGIYIPAALFVVGVAITTYMSGELKILWSLPILFMIIFVRAYSA YKRRRSLYPDRWTSLELEDQTIISKNTALYRFKLKTRLESLDIPAGHHVAVRVPIDGKQE VRYYNPISSKLESGYLDLVVKAYVDGKVSKYFAGLNSGDTVDFKGPIGTLNYEPNSSKHL GIVAGGSGITPVLQILNEIITVPEDLTKVSLLYANETENDILLKDELDEMAEKYPHFQVH YVVHYPSDRWTGDVGYITKDQMNRYLPEYSEDNRLLICGPDGMNNLALQYAKELGWKVNS TRSSGDDQVFVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FMNL3 activation kit by CRISPRa
GA114079 1 Kit

Human FMNL3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Camk4 activation kit by CRISPRa
GA200507 1 Kit

Mouse Camk4 activation kit by CRISPRa

Sign In for Pricing
View Details
Purified Anti-Mouse CD45 Antibody[M1/9.3.4.HL.3]
AN007700P-01 25 µg

Purified Anti-Mouse CD45 Antibody[M1/9.3.4.HL.3]

Sign In for Pricing
View Details
Purified Anti-Mouse CD45 Antibody[M1/9.3.4.HL.3]
AN007700P-02 100 µg

Purified Anti-Mouse CD45 Antibody[M1/9.3.4.HL.3]

Sign In for Pricing
View Details
CO2 Incubator Air Jacketed BCAJ-8402
BCAJ-8402 1 Unit

CO2 Incubator Air Jacketed BCAJ-8402

Sign In for Pricing
View Details
HOXD10 (NM_002148) Human Recombinant Protein
TP760223 50 µg

HOXD10 (NM_002148) Human Recombinant Protein

Sign In for Pricing
View Details