Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0763 (TP_0763)

This Recombinant Treponema pallidum Uncharacterized protein TP_0763 (TP_0763) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0763

UniProt

O83744

Expression Region

1-313

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFLGYIYNCIRIHVSLAPIVEWRPAQAGRQYRRFPMKIKALVVLFNGALLLLCMGTGYV LFLTPVRGTGWQSVRAYGIFFLIFLLLFLLINTLYVKNRRLLRYLDAEDWSALAALLEEE VFTRNRVALRRVSLLSESLILLSDFEALERLEHFVHAQRPRYIMKCALTFAVGKLLAGKY SELRTFMTRVAATQAPVQPWTRFYLAFACHLCGDFEQAHAHLLTLVHTKRQPLIRVLSAY LLSEVLPEKLRRAPAHDAQLIARGCAHAAQVRADVHAHYTPRRWADYENRKKQNVDVLVF LKLMQDARAWLFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 Recombinant Rabbit monoclonal Antibody
HA750112 100 µL

CD63 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS634326 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI3C1]
CF805924 100 µg

Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI3C1]

Sign In for Pricing
View Details
TEX101 (NM_001130011) Human Over-expression Lysate
LY427101 100 µg

TEX101 (NM_001130011) Human Over-expression Lysate

Sign In for Pricing
View Details
Fundc2 (NM_026126) Mouse Tagged ORF Clone
MG201086 10 µg

Fundc2 (NM_026126) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IMP3 (IGF2BP3) Mouse Monoclonal Antibody [Clone ID: OTI6A3]
CF811496 100 µg

IMP3 (IGF2BP3) Mouse Monoclonal Antibody [Clone ID: OTI6A3]

Sign In for Pricing
View Details