Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0763 (TP_0763)

This Recombinant Treponema pallidum Uncharacterized protein TP_0763 (TP_0763) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0763

UniProt

O83744

Expression Region

1-313

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFLGYIYNCIRIHVSLAPIVEWRPAQAGRQYRRFPMKIKALVVLFNGALLLLCMGTGYV LFLTPVRGTGWQSVRAYGIFFLIFLLLFLLINTLYVKNRRLLRYLDAEDWSALAALLEEE VFTRNRVALRRVSLLSESLILLSDFEALERLEHFVHAQRPRYIMKCALTFAVGKLLAGKY SELRTFMTRVAATQAPVQPWTRFYLAFACHLCGDFEQAHAHLLTLVHTKRQPLIRVLSAY LLSEVLPEKLRRAPAHDAQLIARGCAHAAQVRADVHAHYTPRRWADYENRKKQNVDVLVF LKLMQDARAWLFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (Pan Nuclear Marker) (rAE-4), CF488A conjugate, 0.1mg/mL
BNC883518-500 1x 500 µL

Histone H1 (Pan Nuclear Marker) (rAE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse C1qbp activation kit by CRISPRa
GA200461 1 Kit

Mouse C1qbp activation kit by CRISPRa

Sign In for Pricing
View Details
PRB1 (NM_199354) Human Recombinant Protein
TP319911 20 µg

PRB1 (NM_199354) Human Recombinant Protein

Sign In for Pricing
View Details
Human ZNF524 activation kit by CRISPRa
GA115631 1 Kit

Human ZNF524 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human DCR3/TNFRSF6B Protein (Fc Tag)
PKSH031745-01 100 µg

Recombinant Human DCR3/TNFRSF6B Protein (Fc Tag)

Sign In for Pricing
View Details