Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yddM (yddM)

This Recombinant Bacillus subtilis Uncharacterized protein yddM (yddM) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Uncharacterized protein yddM

UniProt

P96650

Expression Region

1-313

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGENMFKKEKVTEYIWTILIPTIITFIISWVGSYYNGTSTVSIGQPTKVSGQYITPINIS PYHDIKELRITFPQKLDVKQISSNEPINVKSDKNNIGVESNSTFEIAKIVENNSVQLLIT TQKKLNDKEIRIDKNGNNISVNYESQIVNPAKKQLINLIITSSIYFIMLNILALIMNKRW DKYYAKMKNEIKEFEDNAKDLDKKSKKKSEELSELRKTLNQAFEETDRIKYHEKKKQILL LAKLNDYKKELTFWRNTIRKVLYELPDGDKKADKLIGTVTSSLKTYGTVEKNEHDYESLK VAAALLNDSDKRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CRACC/SLAMF7 Affinity Purified Polyclonal Ab
AF4628 100 µg

Mouse CRACC/SLAMF7 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Hspb3 ORF Vector (Rat) (pORF)
ORF068423 1.0 µg DNA

Hspb3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Anti-IYD Antibody
39626 100 µL

Anti-IYD Antibody

Sign In for Pricing
View Details
2,3-dihydroxy-1- (7-methoxy-2-oxo-2H-chromen-6-yl) -3-methylbutyl 3-methylbut-2-enoate
orb3171665-01 1 mg

2,3-dihydroxy-1- (7-methoxy-2-oxo-2H-chromen-6-yl) -3-methylbutyl 3-methylbut-2-enoate

Sign In for Pricing
View Details
2,3-dihydroxy-1- (7-methoxy-2-oxo-2H-chromen-6-yl) -3-methylbutyl 3-methylbut-2-enoate
orb3171665-02 2 mg

2,3-dihydroxy-1- (7-methoxy-2-oxo-2H-chromen-6-yl) -3-methylbutyl 3-methylbut-2-enoate

Sign In for Pricing
View Details
2,3-dihydroxy-1- (7-methoxy-2-oxo-2H-chromen-6-yl) -3-methylbutyl 3-methylbut-2-enoate
orb3171665-03 3 mg

2,3-dihydroxy-1- (7-methoxy-2-oxo-2H-chromen-6-yl) -3-methylbutyl 3-methylbut-2-enoate

Sign In for Pricing
View Details