Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnesium transport protein CorA (corA)

This Recombinant Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q7VRM7

Expression Region

1-314

Origin

Blochmannia floridanus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNIFQLKNNCLFRMDSQDVISSINDVIWIDIIQSDDNESHDIQSISEQFKINFFEIKDI LKNKRFCNSKQGVYIRSFFFSYNEDNQIDNSIVSFIICNNCLYTLRESGFSVFCIYQESL NNHVLNDGNAYELLLSLFEVKIDDLTDRIEHIYETLERLSFVIMDEQQIDGYDSILEDLA KLESMSWKIHINLLDTERALQFLVRKVKLPVTQKRHANGILRGITLLLPYNECIFQKVSF LTQSVMGLINIEQNRIIKIFSIVFLPPTLIASSYGMNFEFMPELKWSFGYPSAIFLMILT GLAPYLYFKYKKWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrpl34 (NM_053162) Mouse Tagged ORF Clone
MG200245 10 µg

Mrpl34 (NM_053162) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9) Mouse Monoclonal Antibody [Clone ID: SPM314]
AM50188PU-S 100 µg

Carbonic Anhydrase IX (CA9) Mouse Monoclonal Antibody [Clone ID: SPM314]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total R10Z8E9,  15nm
GM-209-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total R10Z8E9, 15nm

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF594 conjugate, 0.1mg/mL
BNC942337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Human CD134/OX40 Antibody[Ber-ACT35]
E-AB-F1153D-01 20 Tests

PE Anti-Human CD134/OX40 Antibody[Ber-ACT35]

Sign In for Pricing
View Details
PE Anti-Human CD134/OX40 Antibody[Ber-ACT35]
E-AB-F1153D-02 100 Tests

PE Anti-Human CD134/OX40 Antibody[Ber-ACT35]

Sign In for Pricing
View Details