Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnesium transport protein CorA (corA)

This Recombinant Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q7VRM7

Expression Region

1-314

Origin

Blochmannia floridanus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNIFQLKNNCLFRMDSQDVISSINDVIWIDIIQSDDNESHDIQSISEQFKINFFEIKDI LKNKRFCNSKQGVYIRSFFFSYNEDNQIDNSIVSFIICNNCLYTLRESGFSVFCIYQESL NNHVLNDGNAYELLLSLFEVKIDDLTDRIEHIYETLERLSFVIMDEQQIDGYDSILEDLA KLESMSWKIHINLLDTERALQFLVRKVKLPVTQKRHANGILRGITLLLPYNECIFQKVSF LTQSVMGLINIEQNRIIKIFSIVFLPPTLIASSYGMNFEFMPELKWSFGYPSAIFLMILT GLAPYLYFKYKKWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF165 (NM_003447) Human Recombinant Protein
TP305600L 1 mg

ZNF165 (NM_003447) Human Recombinant Protein

Sign In for Pricing
View Details
GALNT3 Rabbit Polyclonal Antibody
TA376468 100 µL

GALNT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GERP (TRIM8) (NM_030912) Human Recombinant Protein
TP305812M 100 µg

GERP (TRIM8) (NM_030912) Human Recombinant Protein

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF594 conjugate, 0.1mg/mL
BNC940826-500 1x 500 µL

Ep-CAM / CD326 (EGP40/826), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS712357 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Recombinant Human RSK4/RPS6KA6 Protein (GST Tag)
PKSH030423 50 µg

Recombinant Human RSK4/RPS6KA6 Protein (GST Tag)

Sign In for Pricing
View Details