Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnesium transport protein CorA (corA)

This Recombinant Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q7VRM7

Expression Region

1-314

Origin

Blochmannia floridanus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNIFQLKNNCLFRMDSQDVISSINDVIWIDIIQSDDNESHDIQSISEQFKINFFEIKDI LKNKRFCNSKQGVYIRSFFFSYNEDNQIDNSIVSFIICNNCLYTLRESGFSVFCIYQESL NNHVLNDGNAYELLLSLFEVKIDDLTDRIEHIYETLERLSFVIMDEQQIDGYDSILEDLA KLESMSWKIHINLLDTERALQFLVRKVKLPVTQKRHANGILRGITLLLPYNECIFQKVSF LTQSVMGLINIEQNRIIKIFSIVFLPPTLIASSYGMNFEFMPELKWSFGYPSAIFLMILT GLAPYLYFKYKKWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PACSIN3 Antibody
RC-5543-01 50 μL

Recombinant PACSIN3 Antibody

Sign In for Pricing
View Details
Recombinant PACSIN3 Antibody
RC-5543-02 100 µL

Recombinant PACSIN3 Antibody

Sign In for Pricing
View Details
Recombinant PACSIN3 Antibody
RC-5543-03 1 mL

Recombinant PACSIN3 Antibody

Sign In for Pricing
View Details
UACA / Nucling (AE-5), CF568 conjugate, 0.1mg/mL
BNC680956-500 1x 500 µL

UACA / Nucling (AE-5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Purified Anti-Mouse IL-17A Antibody[17F3]
E-AB-F1272A-01 25 µg

Purified Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details
Purified Anti-Mouse IL-17A Antibody[17F3]
E-AB-F1272A-02 100 µg

Purified Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details