Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL36 (ATL36)

This Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL36 (ATL36) spans the amino acid sequence from region 32-345.

Product Specifications

Product Name Alternative

Putative RING-H2 finger protein ATL36

UniProt

Q9M0R5

Expression Region

32-345

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQESVPTNSIRQTNLSADSIIAIVVLAIFISLGMVSCCLHCIFYREEIGAAGQDVLHSRA RRGLEKEVIESFPTFLYSEVKGLKIGKGGVECAICLSEFEDQETLRWMPPCSHTFHANCI DVWLSSWSTCPVCRANLSLKPGESYPYLNMDVETGGVQKLPNERSLTGNSVTTRSRSTGL LSSWRMAEIFVPRSHSTGHSLVQQLGENLDRFTLQLPEEVQRQLVSLNLIRRSHIVLPQA VSSRQGYRSGSVGSERGGFSQGRQTHRRALSMSFSFSFQTASVRSIHDMNDQAQAKDKYF GERSFERLMPEEKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-500 1x 500 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF647 conjugate, 0.1mg/mL
BNC471564-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), CF640R conjugate, 0.1mg/mL
BNC400282-100 1x 100 µL

HER-2 / CD340 (HRB2/282), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details