Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Thioredoxin-related transmembrane protein 4 (Tmx4)

This Recombinant Mouse Thioredoxin-related transmembrane protein 4 (Tmx4) spans the amino acid sequence from region 21-335.

Product Specifications

Product Name Alternative

Thioredoxin-related transmembrane protein 4, Thioredoxin domain-containing protein 13

UniProt

Q8C0L0

Expression Region

21-335

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EGLEQAALPAEESRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWETFAKNGETL QISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIYEDLQNYILEKKWQSVE PLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMG LILVVISECFCVPLPRASSERCEQEQSTGEAQGAEQLQDAEEEKDDSNEEENKDSLVDDE EEKEDIGDEDEGEEDEEEDNLAGIMAEERSDTNERAVVKEGSVSPKEDGAHPADTQDVVE DALRQRKSQNANKGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2X Protein Loading Buffer Blue
EC-886 10x 1 mL

2X Protein Loading Buffer Blue

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Blue, Elab Fluor® Violet 450)
E-CK-A423-01 20 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Blue, Elab Fluor® Violet 450)

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Blue, Elab Fluor® Violet 450)
E-CK-A423-02 100 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Blue, Elab Fluor® Violet 450)

Sign In for Pricing
View Details
Myelin Basic Protein (MBP) Rabbit Monoclonal Antibody
TA422879 100 µL

Myelin Basic Protein (MBP) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
P27 / KIP1 (KIP1/769), Biotin conjugate, 0.1mg/mL
BNCB0769-500 1x 500 µL

P27 / KIP1 (KIP1/769), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant RBBP7/RBBP4 Monoclonal Antibody
AN302067L-01 50 µL

Recombinant RBBP7/RBBP4 Monoclonal Antibody

Sign In for Pricing
View Details