Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 231 (Tmem231)

This Recombinant Rat Transmembrane protein 231 (Tmem231) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Transmembrane protein 231

UniProt

Q5FVM1

Expression Region

1-315

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALYHLFSHPIERAYRAGLCSKAALFLLLATALTYIPPLLVAFRSHGFWLKRSNYEEQPN VRFQHQVLLVALLGPEPGAFLAWSTYPTFNRLQGVHLRVPLVSTREEDRNQDGKMDVLYF KLELPLQSTEQVLGVQLILTFSYQLHRMSTFEMQSMAFLQSSFAVPGSQLHVNGDLRLQQ KQPLSYRGLDVRYNVSVINGTSPFAHDYDLTHIVAAYQERNVTTVLSDPNPIWLVGRAAE APFVIDAVIRYPVEVISYQPGFWEMIKFAWIQYVSILLIFLWVFERIKIFVFQNQVVTSI PVAVPQGEIRKEHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-conjugated Rabbit Anti-Human IgG H&L
HY-P87393-01 50 μL

HRP-conjugated Rabbit Anti-Human IgG H&L

Sign In for Pricing
View Details
HRP-conjugated Rabbit Anti-Human IgG H&L
HY-P87393-02 100 µL

HRP-conjugated Rabbit Anti-Human IgG H&L

Sign In for Pricing
View Details
SEPTIN6 antibody
FNab07725 100 µg

SEPTIN6 antibody

Sign In for Pricing
View Details
RAB23 (NM_016277) Human Tagged ORF Clone Lentiviral Particle
RC201922L2V 200 µL

RAB23 (NM_016277) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
p90RSK (Ab-348) Conjugated Antibody
C21135 100 µL

p90RSK (Ab-348) Conjugated Antibody

Sign In for Pricing
View Details
Porcine S100 Calcium Binding Protein A12 (S100A12) ELISA Kit-Sandwich
EK9F704-01 48 Test

Porcine S100 Calcium Binding Protein A12 (S100A12) ELISA Kit-Sandwich

Sign In for Pricing
View Details