Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 231 (Tmem231)

This Recombinant Rat Transmembrane protein 231 (Tmem231) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Transmembrane protein 231

UniProt

Q5FVM1

Expression Region

1-315

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALYHLFSHPIERAYRAGLCSKAALFLLLATALTYIPPLLVAFRSHGFWLKRSNYEEQPN VRFQHQVLLVALLGPEPGAFLAWSTYPTFNRLQGVHLRVPLVSTREEDRNQDGKMDVLYF KLELPLQSTEQVLGVQLILTFSYQLHRMSTFEMQSMAFLQSSFAVPGSQLHVNGDLRLQQ KQPLSYRGLDVRYNVSVINGTSPFAHDYDLTHIVAAYQERNVTTVLSDPNPIWLVGRAAE APFVIDAVIRYPVEVISYQPGFWEMIKFAWIQYVSILLIFLWVFERIKIFVFQNQVVTSI PVAVPQGEIRKEHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tube Furnace (BFTU-1100-75-800)
BFTU-1100-75-800 1 Unit

Tube Furnace (BFTU-1100-75-800)

Sign In for Pricing
View Details
BC048671 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4273102 1.0 µg DNA

BC048671 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
GENLISA™ Human Survival Motor Neuron Domain Containing Protein 1 (SMNDC1) ELISA
KBH22463 1x 96 Well

GENLISA™ Human Survival Motor Neuron Domain Containing Protein 1 (SMNDC1) ELISA

Sign In for Pricing
View Details
DES Conjugated Antibody
MBS9452172-01 0.1 mL (Biotin)

DES Conjugated Antibody

Sign In for Pricing
View Details
DES Conjugated Antibody
MBS9452172-02 0.1 mL (AF350)

DES Conjugated Antibody

Sign In for Pricing
View Details
DES Conjugated Antibody
MBS9452172-03 0.1 mL (AF405)

DES Conjugated Antibody

Sign In for Pricing
View Details