Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized PPE family protein PPE66 (ppe66)

This Recombinant Uncharacterized PPE family protein PPE66 (ppe66) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Uncharacterized PPE family protein PPE66

UniProt

Q79FA3

Expression Region

1-315

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAYASALAAMPTLTELAANHTSHAVLLGTNFFGINTIPIALNEADYARMWIQAATTMS IYEGTSDAALASAPQTTPAPVLFNGGAGVASALPAISAATLDPASIIGIIIEILIQLFLI SLEILFAIVAYTIIIVLILPLVIFAYAIVFAVLAIIFGPPLLVIASPFVLTGSVIAVPTS LSTSLSTAVPIGVGQYLADLASADAQAIEVGLKTADVAPVAVRPAAAPPLRESAAVRPEA RLVSAVAPAPAGTSASVLASDRGAGVLGFAGTAGKESVGRPAGLTTLAGGEFGGSPSVPM VPASWEQLVGAGEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Geniposide
AB1226 20 mg

Geniposide

Sign In for Pricing
View Details
GNE-490 100mg
A22231-100 100 mg

GNE-490 100mg

Sign In for Pricing
View Details
KRT19 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV672868 1.0 µg DNA

KRT19 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Monoamine Oxidase B (MAOB) Goat Polyclonal Antibody
TA302534 100 µg

Monoamine Oxidase B (MAOB) Goat Polyclonal Antibody

Sign In for Pricing
View Details
KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) (MaxLight 490)
MBS6201549-01 0.1 mL

KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) (MaxLight 490)

Sign In for Pricing
View Details
KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) (MaxLight 490)
MBS6201549-02 5x 0.1 mL

KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) (MaxLight 490)

Sign In for Pricing
View Details