Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized PPE family protein PPE66 (ppe66)

This Recombinant Uncharacterized PPE family protein PPE66 (ppe66) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Uncharacterized PPE family protein PPE66

UniProt

Q79FA3

Expression Region

1-315

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAYASALAAMPTLTELAANHTSHAVLLGTNFFGINTIPIALNEADYARMWIQAATTMS IYEGTSDAALASAPQTTPAPVLFNGGAGVASALPAISAATLDPASIIGIIIEILIQLFLI SLEILFAIVAYTIIIVLILPLVIFAYAIVFAVLAIIFGPPLLVIASPFVLTGSVIAVPTS LSTSLSTAVPIGVGQYLADLASADAQAIEVGLKTADVAPVAVRPAAAPPLRESAAVRPEA RLVSAVAPAPAGTSASVLASDRGAGVLGFAGTAGKESVGRPAGLTTLAGGEFGGSPSVPM VPASWEQLVGAGEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XTP3TPA/DCTPP1 Rabbit Polyclonal Antibody (Cy3)
orb2597438 100 µg

XTP3TPA/DCTPP1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
TLR9 Rabbit Polyclonal Antibody (Cy5)
orb903621 100 µL

TLR9 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii rimP Protein (aa 1-176)
VAng-Yyj5107-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Vanbaalenii rimP Protein (aa 1-176)

Sign In for Pricing
View Details
UCK1, CT (UCK1, URK1, Uridine-cytidine kinase 1, Cytidine monophosphokinase 1, Uridine monophosphokinase 1) (FITC)
MBS6361072-01 0.2 mL

UCK1, CT (UCK1, URK1, Uridine-cytidine kinase 1, Cytidine monophosphokinase 1, Uridine monophosphokinase 1) (FITC)

Sign In for Pricing
View Details
UCK1, CT (UCK1, URK1, Uridine-cytidine kinase 1, Cytidine monophosphokinase 1, Uridine monophosphokinase 1) (FITC)
MBS6361072-02 5x 0.2 mL

UCK1, CT (UCK1, URK1, Uridine-cytidine kinase 1, Cytidine monophosphokinase 1, Uridine monophosphokinase 1) (FITC)

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum PF14_0425 Protein (aa 1-369)
VAng-Wyb6669-1mgEcoli 1 mg (E. coli)

Recombinant Plasmodium Falciparum PF14_0425 Protein (aa 1-369)

Sign In for Pricing
View Details