Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized PPE family protein PPE66 (ppe66)

This Recombinant Uncharacterized PPE family protein PPE66 (ppe66) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Uncharacterized PPE family protein PPE66

UniProt

Q79FA3

Expression Region

1-315

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAYASALAAMPTLTELAANHTSHAVLLGTNFFGINTIPIALNEADYARMWIQAATTMS IYEGTSDAALASAPQTTPAPVLFNGGAGVASALPAISAATLDPASIIGIIIEILIQLFLI SLEILFAIVAYTIIIVLILPLVIFAYAIVFAVLAIIFGPPLLVIASPFVLTGSVIAVPTS LSTSLSTAVPIGVGQYLADLASADAQAIEVGLKTADVAPVAVRPAAAPPLRESAAVRPEA RLVSAVAPAPAGTSASVLASDRGAGVLGFAGTAGKESVGRPAGLTTLAGGEFGGSPSVPM VPASWEQLVGAGEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GRM5 shRNA (UAS) - Lentiviral human GRM5 shRNA (UAS, GFP) (100)
GTR15349668 1 Vial

Lentiviral human GRM5 shRNA (UAS) - Lentiviral human GRM5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-MSK1/RPS6KA5 Antibody Picoband® (Cy3 Conjugate)
PB9268-Cy3 100 µg/Vial

Anti-MSK1/RPS6KA5 Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
Mouse Monoclonal DGK-beta Antibody (OTI1F9) [FITC]
NBP2-70552F 0.1 mL

Mouse Monoclonal DGK-beta Antibody (OTI1F9) [FITC]

Sign In for Pricing
View Details
H2al1a Mouse Gene Knockout Kit (CRISPR)
KN506706 1 Kit

H2al1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Pou5f1 Pre-designed siRNA Set B
SI110945B 1 Each

Mouse Pou5f1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Atrial Natriuretic Factor (ANF) Human ELISA Kit
10199 96 Tests

Atrial Natriuretic Factor (ANF) Human ELISA Kit

Sign In for Pricing
View Details