Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnesium transport protein CorA (corA)

This Recombinant Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q8D2T1

Expression Region

1-315

Origin

Wigglesworthia glossinidia brevipalpis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNAFKLHKKNLFRINIDQSSLIKSIWIDIVNLTEEERRRIQNELGQNLSTSLDLEDIEA SARFFEDKEGLHIHSFFFFADAEDHVGNSTVAFIIKNNILYTLRERDLPAFRLYRMRARN QTLKDGNAYEVLLDLFETKIEQLADEIENIYSDLETLSIIIMEGRKSNEYDNALSTLAEL EDVGWKVRLCLMDTQRAINFLSKKKHIPYEQLDQAKGILHDIDSLLPHNESLFQKVNFLM QAAMGFINIEQNRIIKIFSVVSVIFLPPTLVASSYGMNFDFMPELKWPLGYPIAILEMIL AGLAPYLYFRRKKWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBXN8 Human qPCR Primer Pair (BC020694)
HP223579 200 Reactions

UBXN8 Human qPCR Primer Pair (BC020694)

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(S)-1-(3-Fluororopyridin-2-yl)ethylamine Hydrochloride
TRC-F595865-500MG 500 mg

(S)-1-(3-Fluororopyridin-2-yl)ethylamine Hydrochloride

Sign In for Pricing
View Details
HOXC11 Polyclonal Antibody
E-AB-90943-01 60 µL

HOXC11 Polyclonal Antibody

Sign In for Pricing
View Details
HOXC11 Polyclonal Antibody
E-AB-90943-02 120 µL

HOXC11 Polyclonal Antibody

Sign In for Pricing
View Details
HOXC11 Polyclonal Antibody
E-AB-90943-03 200 µL

HOXC11 Polyclonal Antibody

Sign In for Pricing
View Details