Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YHL026C (YHL026C)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YHL026C (YHL026C) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Uncharacterized protein YHL026C

UniProt

P38740

Expression Region

1-315

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSSEPAPATPTGFRNSIWFIIFYLFVIQALGSAIISGGIEFAIAYAMYHSRVDLITLWA FPHTISGDCALSLFIQVGLTWASEEILVGFDDYKRPVFRLNKWITKPSPLKTESNEEIPP PKKRFIVDYFESKDNVVAKQNTLYHKHNWLFGYLEVNRGIIPKGKEATLKGFLTSQFIHD STQSKFMNFIEWFVQKFIRSMILAIAMFIVIWPVTMGILAGIGHKVGSHDYYFNDYPLPQ VMKLIYAVVIAFVCTPVAIIVIVLRNQFHEELYYEGLANGTLQQDQEVCSTGNRSSGSTD QDISTTKQQSQEAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-100 1x 100 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-500 1x 500 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF640R conjugate, 0.1mg/mL
BNC402312-100 1x 100 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details