Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnesium transport protein CorA (corA)

This Recombinant Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

P0ABI6

Expression Region

1-316

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSAFQLENNRLTRLEVEESQPLVNAVWIDLVEPDDDERLRVQSELGQSLATRPELEDIE ASARFFEDDDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTLRERELPAFRLYRMRAR SQSMVDGNAYELLLDLFETKIEQLADEIENIYSDLEQLSRVIMEGHQGDEYDEALSTLAE LEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRDIESLLPHNESLFQKVNFL MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIIFMI LAGLAPYLYFKRKNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAP97 (DLG1) (NM_004087) Human Over-expression Lysate
LY418230 100 µg

SAP97 (DLG1) (NM_004087) Human Over-expression Lysate

Sign In for Pricing
View Details
Olfactory Marker Protein (OMP) (N-term) Rabbit Polyclonal Antibody
AP52997PU-N 400 µL

Olfactory Marker Protein (OMP) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KLF4 (1-170) Mouse Monoclonal Antibody [Clone ID: AT4E6]
AM09057PU-S 50 µL

KLF4 (1-170) Mouse Monoclonal Antibody [Clone ID: AT4E6]

Sign In for Pricing
View Details
STEAP3 Human Gene Knockout Kit (CRISPR)
KN210595 1 Kit

STEAP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SAE1 (NM_016402) Human Over-expression Lysate
LY429497 100 µg

SAE1 (NM_016402) Human Over-expression Lysate

Sign In for Pricing
View Details
Stathmin 1 (Ab-15) Antibody
8B7230-AAT 50 µg

Stathmin 1 (Ab-15) Antibody

Sign In for Pricing
View Details