Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnesium transport protein CorA (corA)

This Recombinant Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

P0ABI5

Expression Region

1-316

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSAFQLENNRLTRLEVEESQPLVNAVWIDLVEPDDDERLRVQSELGQSLATRPELEDIE ASARFFEDDDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTLRERELPAFRLYRMRAR SQSMVDGNAYELLLDLFETKIEQLADEIENIYSDLEQLSRVIMEGHQGDEYDEALSTLAE LEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRDIESLLPHNESLFQKVNFL MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIIFMI LAGLAPYLYFKRKNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP13 Mouse Monoclonal Antibody [Clone ID: OTI2F5]
CF809737 100 µg

TRIP13 Mouse Monoclonal Antibody [Clone ID: OTI2F5]

Sign In for Pricing
View Details
MEGF6 sgRNA CRISPR Lentivector (Human) (Target 3)
K1288604 1.0 µg DNA

MEGF6 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
S-3- (Acetoxymethyl) -9- (2- (dimethylamino) ethyl) -3,4-dihydro-1H-pyrrolo[2,3-h]isoquinoline-2 (7H) -carboxylic Acid tert-Butyl Ester
465399-01 500 µg

S-3- (Acetoxymethyl) -9- (2- (dimethylamino) ethyl) -3,4-dihydro-1H-pyrrolo[2,3-h]isoquinoline-2 (7H) -carboxylic Acid tert-Butyl Ester

Sign In for Pricing
View Details
S-3- (Acetoxymethyl) -9- (2- (dimethylamino) ethyl) -3,4-dihydro-1H-pyrrolo[2,3-h]isoquinoline-2 (7H) -carboxylic Acid tert-Butyl Ester
465399-02 5 mg

S-3- (Acetoxymethyl) -9- (2- (dimethylamino) ethyl) -3,4-dihydro-1H-pyrrolo[2,3-h]isoquinoline-2 (7H) -carboxylic Acid tert-Butyl Ester

Sign In for Pricing
View Details
Human Monoclonal CTLA-4 Antibody (nurulimab) [CoraFluor 1]
NBP3-28726CL1 0.1 mL

Human Monoclonal CTLA-4 Antibody (nurulimab) [CoraFluor 1]

Sign In for Pricing
View Details
DAPK3 (Ab-265) Antibody
orb193071-01 50 μL

DAPK3 (Ab-265) Antibody

Sign In for Pricing
View Details