Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 39, mitochondrial (AIM39)

This Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 39, mitochondrial (AIM39) spans the amino acid sequence from region 30-345.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 39, mitochondrial

UniProt

A7TP86

Expression Region

30-345

Origin

Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SNDSKYFFSKPPANDNNDKGSYADSKHFFTKPNGKMNSNEQIDQMHNNGSNNPNNNKNGS TDSLIGQAILQQRRERRKQVWYALGISIFAVLIGYSIGYKVIYLNEDSFIPLYPSSGIRK PSQNDLRKIDVPHIKLISHLRVLEVLSHHDMIKEQYGVPLHDSNGVNPPQIKEFNIWCED QDPCVTGLIIRKDDPNRPTTHTWHRIPYLLQWRVTHRPICISRSISNFLEDIGLSYSTIY EIISPEKIYGSFKYEYPIPGDDHSMHIWFLGELQLNNDTLIIYKGKYHVDVKLQQVDLLR NEDGKLVRYVLFKENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-100 1x 100 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-500 1x 500 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
BNC880012-500 1x 500 µL

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details