Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0878 (TP_0878)

This Recombinant Treponema pallidum Uncharacterized protein TP_0878 (TP_0878) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0878

UniProt

O83848

Expression Region

1-316

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSVDSRSSVTRWVCLTSVILFCFCIAVMRYGGVKKRRYFYGFCLHPRERADITEVILRF PREERNASRELRWVKKDRQWFIQLAHAIHPAKQEVLERLFQYLFTKRRFEFITNNTRFFS DYALGKQPAVQMKFTKKNGAAIGDIYFGALNGTGLGRYIRIGDNAAVFLTEDDFTPFFRD EKRFWCDTRQFHELFTQSQIQMMEVSGKYIVRSRTSVVFKEVEQFFARFSYVDVGPTPTQ WKESIVIHRGDGKIIRFRLQPAAHQEWTLWDAQSVHAYTLSAYTARYLFALISRMQTETG MSSLQQFDTEENLISD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetic-2,2,2-d3 Acid
TRC-A167646-500MG 500 mg

Acetic-2,2,2-d3 Acid

Sign In for Pricing
View Details
CRYBA2 Human Gene Knockout Kit (CRISPR)
KN402403 1 Kit

CRYBA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD43 (SPN/1094), Biotin conjugate, 0.1mg/mL
BNCB1094-500 1x 500 µL

CD43 (SPN/1094), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PROX1 Rabbit Polyclonal Antibody
TA371470 100 µL

PROX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Actc1 activation kit by CRISPRa
GA200044 1 Kit

Mouse Actc1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant AKT1 (phospho S473) Antibody
RC-16769-01 50 μL

Recombinant AKT1 (phospho S473) Antibody

Sign In for Pricing
View Details