Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 59-like (Tmem59l)

This Recombinant Mouse Transmembrane protein 59-like (Tmem59l) spans the amino acid sequence from region 22-337.

Product Specifications

Product Name Alternative

Transmembrane protein 59-like, Brain-specific membrane-anchored protein

UniProt

Q7TNI2

Expression Region

22-337

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RDPFAPQLGDTQRCQQRCRQHHPGSPPAQPEPEGPSESPNNKAILISACERGCRLFSICR FVAKSSRPNATETECEAACTEAYVKAAEQRACSEGCWGQIPEPETQLEQKDLALDPPRGR LSLRYLFSMLCSDLMSSAQGFLSSSWTYSLQTDNRKVVVFQTQPVAENFAFQGSHLQRVE VTWRRSHPKALELHMDPVGPLDKVRKAKPRVKTSKAKVESEDQQESDFLSCMSRRSGLPR WVLFCCLFLSILIMLWLSCCTLVTTPGQHLKFQPLTAEQHKGLLVESDWPLYPPLPPPAY EDSTPPYKLKLDLTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Insulin (INS) ELISA Kit
orb1665328-01 48 Tests

Rabbit Insulin (INS) ELISA Kit

Sign In for Pricing
View Details
Rabbit Insulin (INS) ELISA Kit
orb1665328-02 96 Tests

Rabbit Insulin (INS) ELISA Kit

Sign In for Pricing
View Details
Human PINK1 AssayLite™ Antibody (APC Conjugate)
33301-05161 5x 30 µg

Human PINK1 AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
SERPINA3 Polyclonal Antibody
RD75451A-01 20 µL

SERPINA3 Polyclonal Antibody

Sign In for Pricing
View Details
SERPINA3 Polyclonal Antibody
RD75451A-02 60 μL

SERPINA3 Polyclonal Antibody

Sign In for Pricing
View Details
SERPINA3 Polyclonal Antibody
RD75451A-03 120 μL

SERPINA3 Polyclonal Antibody

Sign In for Pricing
View Details