Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 59-like (Tmem59l)

This Recombinant Mouse Transmembrane protein 59-like (Tmem59l) spans the amino acid sequence from region 22-337.

Product Specifications

Product Name Alternative

Transmembrane protein 59-like, Brain-specific membrane-anchored protein

UniProt

Q7TNI2

Expression Region

22-337

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RDPFAPQLGDTQRCQQRCRQHHPGSPPAQPEPEGPSESPNNKAILISACERGCRLFSICR FVAKSSRPNATETECEAACTEAYVKAAEQRACSEGCWGQIPEPETQLEQKDLALDPPRGR LSLRYLFSMLCSDLMSSAQGFLSSSWTYSLQTDNRKVVVFQTQPVAENFAFQGSHLQRVE VTWRRSHPKALELHMDPVGPLDKVRKAKPRVKTSKAKVESEDQQESDFLSCMSRRSGLPR WVLFCCLFLSILIMLWLSCCTLVTTPGQHLKFQPLTAEQHKGLLVESDWPLYPPLPPPAY EDSTPPYKLKLDLTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to SLC27A5
sAP-0954 50 µg

Mouse Monoclonal Antibody to SLC27A5

Sign In for Pricing
View Details
DnaJB4 discontinued
342980-01 100 µL

DnaJB4 discontinued

Sign In for Pricing
View Details
DnaJB4 discontinued
342980-02 200 µL

DnaJB4 discontinued

Sign In for Pricing
View Details
ZNF316 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2698807 1.0 µg DNA

ZNF316 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human DLX5 Affinity Purified Polyclonal Ab
AF6710 100 µg

Human DLX5 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
FEN1 Mouse Monoclonal Antibody [Clone ID: LBI1E1]
AMM15633VCF 100 µg

FEN1 Mouse Monoclonal Antibody [Clone ID: LBI1E1]

Sign In for Pricing
View Details