Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnesium transport protein CorA (corA)

This Recombinant Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q66FY7

Expression Region

1-316

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSAFKLHNNRLSRLELDESDDLASSLWVDLVEPEEGERERVQTELGQSLATRPELDDIE ASARFFEDEDGLHIHSFFYYEDADDHAGNSTVAFTIRDGRLYTLRERELPAFRLYRMRAR NQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLEALSRVIMEGQQGDEYDAALSTLAE QEDIGWKVRLCLMDTQRALNFLVRKARLPSSQLEQAREVLRDIESLLPHNESLFQKVNFL MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELRWSFGYPGAIALMI IAGLAPYLYFKRKNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rassf5 Mouse Gene Knockout Kit (CRISPR)
KN514519 1 Kit

Rassf5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Folr1 Mouse Gene Knockout Kit (CRISPR)
KN306057 1 Kit

Folr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ezrin / p81 (CPTC-Ezrin-1), CF488A conjugate, 0.1mg/mL
BNC882238-500 1x 500 µL

Ezrin / p81 (CPTC-Ezrin-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS4), CF647 conjugate, 0.1mg/mL
BNC471744-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), 0.2mg/mL
BNUB2044-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), 0.2mg/mL

Sign In for Pricing
View Details
CHRNA3 Rabbit Polyclonal Antibody
ER1902-13 100 µL

CHRNA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details