Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnesium transport protein CorA (corA)

This Recombinant Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q66FY7

Expression Region

1-316

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSAFKLHNNRLSRLELDESDDLASSLWVDLVEPEEGERERVQTELGQSLATRPELDDIE ASARFFEDEDGLHIHSFFYYEDADDHAGNSTVAFTIRDGRLYTLRERELPAFRLYRMRAR NQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLEALSRVIMEGQQGDEYDAALSTLAE QEDIGWKVRLCLMDTQRALNFLVRKARLPSSQLEQAREVLRDIESLLPHNESLFQKVNFL MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELRWSFGYPGAIALMI IAGLAPYLYFKRKNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (Macrophage Marker) (LAMP4/1830), CF405S conjugate, 0.1mg/mL
BNC041830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PGRMC2 activation kit by CRISPRa
GA107107 1 Kit

Human PGRMC2 activation kit by CRISPRa

Sign In for Pricing
View Details
LOC339193 Human qPCR Primer Pair (XM_290751)
HP221390 200 Reactions

LOC339193 Human qPCR Primer Pair (XM_290751)

Sign In for Pricing
View Details
SF3A3 Rabbit Monoclonal Antibody
TA424420 100 µL

SF3A3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NF2 (NM_181831) Human Over-expression Lysate
LY430575 100 µg

NF2 (NM_181831) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TSPY4 activation kit by CRISPRa
GA118939 1 Kit

Human TSPY4 activation kit by CRISPRa

Sign In for Pricing
View Details