Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Magnesium transport protein CorA (corA)

This Recombinant Salmonella paratyphi A Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q5PKM1

Expression Region

1-316

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSAFQLEKNRLTRLEVEESQSLIDAVWVDLVEPDDDERLRVQSELGQSLATRPELEDIE ASARFFEDEDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTLRERELPAFRLYRMRAR SQAMVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSRVIMEGHQGDEYDEALSTLAE LEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRDIESLLPHNESLFQKVNFL MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIIFMI LAGLAPYLYFKRKNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-500 1x 500 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF594 conjugate, 0.1mg/mL
BNC940778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF740 conjugate, 0.1mg/mL
BNC741224-500 1x 500 µL

HCG-beta (HCGb/54+ HCGb/459), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/261), CF488A conjugate, 0.1mg/mL
BNC880261-100 1x 100 µL

CD66 (CEA) (C66/261), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details