Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photorhabdus luminescens subsp. laumondii Magnesium transport protein CorA (corA)

This Recombinant Photorhabdus luminescens subsp. laumondii Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q7MYP0

Expression Region

1-316

Origin

Photorhabdus luminescens subsp. laumondii (strain TT01)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSAFKLENNRLLRLEFEEGEKLSDSLWVDLVEPAEQDRLQVQNELGQILATRPELDDIE ASARFFEDEDGIHVHSFFYFEDAEDHAGNATVAFTIRDGRLYTLRERELPAFRLYRMRAR NQTLVDGNAYEVLMDLFETKIEQLADVIENIYSVLESLSRVIMEGKQGDEFDIALSSLAE QEDISWKVRLCLMDTQRALNFLVRRARLPGAQLEQAREILRDIESLLPHNESLFQKVNFL MQAAMGFINIEQSRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELHWTFGYPGAIGLMI AAGLAPYLYFKRKNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-100 1x 100 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF640R conjugate, 0.1mg/mL
BNC401462-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-alpha (HCGa/53), CF488A conjugate, 0.1mg/mL
BNC880053-100 1x 100 µL

HCG-alpha (HCGa/53), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details