Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Magnesium transport protein CorA (corA)

This Recombinant Pasteurella multocida Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q9CLC4

Expression Region

1-316

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINAFALEDARLVRIDENTNAELNSAIWLDLIEPSSEEREILQEGLGQSLATFLELEDIE ASARFFEDEDGLHLHSFFYCEDEEDYADLASVAFTVRDGRLFTLRDRELPAFRLYRMRSR SQRLIECNAYEVLLDLFETKIEQLADVIETVYSDLEKLSRVILDGTQGEAFDQALSTLTE QEDTSSKVRLCLMDTQRALSFLVRKTRLPANQLEQAREILRDIESLQPHNESLFQRVNFL MQAAMGFISIEQNRIIKIFSVVSVIFLPPTLVASNYGMNFDIMPELGFKFGYPMALGLMA LAAFAPYWYFKRKGWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FISH (SH3PXD2A) Mouse Monoclonal Antibody [Clone ID: OTI1H9]
CF811758 100 µg

FISH (SH3PXD2A) Mouse Monoclonal Antibody [Clone ID: OTI1H9]

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF568 conjugate, 0.1mg/mL
BNC682430-100 1x 100 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Succinamic Acid NHS Ester PEG
1210000-35.5G 5 g

Ɑ-Methoxy-ω-Succinamic Acid NHS Ester PEG

Sign In for Pricing
View Details
Volinanserin Hydrochloride Salt
TRC-V755000-25MG 25 mg

Volinanserin Hydrochloride Salt

Sign In for Pricing
View Details
MIR6791 Human qPCR Primer Pair (MI0022636)
HP301392 200 Reactions

MIR6791 Human qPCR Primer Pair (MI0022636)

Sign In for Pricing
View Details
Golgi Complex (371-4), CF405S conjugate, 0.1mg/mL
BNC040102-500 1x 500 µL

Golgi Complex (371-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details