Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Metaxin-1 (MTX1)

This Recombinant Pig Metaxin-1 (MTX1) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Metaxin-1, Mitochondrial outer membrane import complex protein 1

UniProt

Q27HK4

Expression Region

1-317

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPMELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKITNPWRSPSGTLPALRTSQ GEVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWVDAKNYV EVTRKWYAEAMPFPLNFFLPGRMQRQYMERLQLLCGEHRPEEEEELEKELYQEARECLTL LSQRLGAQKFFFGDAPASLDAFVFSYLALLQQAKLPSGKLQAHLRGLHNLCAYCTHILSL YFPWEGAEVPRPRQTPASSETEEEPYRRRNQILSVLAGLAAMAGYALLSGIVSIQRAPPA RAPSTRALGMAEEDEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF640R conjugate, 0.1mg/mL
BNC402043-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details