Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Metaxin-1 (MTX1)

This Recombinant Macaca fascicularis Metaxin-1 (MTX1) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Metaxin-1, Mitochondrial outer membrane import complex protein 1

UniProt

Q4R3I0

Expression Region

1-317

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPMELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKISNPWRSPSGTLPALRTSH GEVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYV EVTRKWYAEAMPFPLNFFLPGRMQRQYMERLELLSGEHMPEDEEELEKELYREARECLTL LSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQAHLRGLHNLCAYCTHILSL YFPWDGAEVPPPRQTPAGPETEEEPYRRRNQILSVLAGLAAMVGYALLSGIVSIQRATPA RAPGTRALGMAEEDEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-100 1x 100 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF640R conjugate, 0.1mg/mL
BNC402350-500 1x 500 µL

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2644), CF740 conjugate, 0.1mg/mL
BNC742644-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2644), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details