Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Magnesium transport protein CorA (corA)

This Recombinant Bacillus subtilis Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

P40948

Expression Region

1-317

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKAHTGKDWFWYQMGPQERSKARDLIHFSHWPQCEKWFENNHHVNFLRVDTTETENEAVF GSIVYDQGLGEEKDHTVFHFYITRQYFFTINFDFSILREIKGKEVVRQMERADNAIEGFL ILLGELMNAYLIGVDEFEVKLRKLRWQIKDDNSKSILNRVHLLRHELMIWKNLILSAKKI EMALKETFLPQNEGKKDYQRTQLKIDRGFTYISEFEGELNNLLHSEEVITSHRGNEIVKA LTIFTTLFTPITALGALWGMNFSVMPELNWKYGYLFSLLLIVTSTVLIYLYLRKKGWTGD MLQERKKKKKPRKRRTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-500 1x 500 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF568 conjugate, 0.1mg/mL
BNC681712-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF640R conjugate, 0.1mg/mL
BNC401387-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details