Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine polyomavirus Minor capsid protein VP2

This Recombinant Murine polyomavirus Minor capsid protein VP2 spans the amino acid sequence from region 2-319.

Product Specifications

Product Name Alternative

Minor capsid protein VP2, Minor structural protein VP2

UniProt

P03097

Expression Region

2-319

Origin

Murine polyomavirus (strain 3) (MPyV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAALTILVDLIEGLAEVSTLTGLSAEAILSGEALAALDGEITALTLEGVMSSETALATMG ISEEVYGFVSTVPVFVNRTAGAIWLMQTVQGASTISLGIQRYLHNEEVPTVNRNMALIPW RDPALLDIYFPGVNQFAHALNVVHDWGHGLLHSVGRYVWQMVVQETQHRLEGAVRELTVR QTHTFLDGLARLLENTRWVVSNAPQSAIDAINRGASSVSSGYSSLSDYYRQLGLNPPQRR ALFNRIEGSMGNGGPTPAAHIQDESGEVIKFYQAPGGAHQRVTPDWMLPLILGLYGDITP TWATVIEEDGPQKKKRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Fusobacterium nucleatum subsp.nucleatum Threonine--tRNA ligase (thrS), partial
MBS1444870 Inquire

Recombinant Fusobacterium nucleatum subsp.nucleatum Threonine--tRNA ligase (thrS), partial

Sign In for Pricing
View Details
DCDC2 Rabbit pAb
E45R23913N-100 100 µL

DCDC2 Rabbit pAb

Sign In for Pricing
View Details
Alpha- (p-Chlorophenyl) cinnamomnitrile
C17290 5 g

Alpha- (p-Chlorophenyl) cinnamomnitrile

Sign In for Pricing
View Details
C1q Receptor, gamma (gC1qR, C1qBP, Complement Component 1, Q Subcomponent-binding Protein)
MBS646522-01 0.1 mg

C1q Receptor, gamma (gC1qR, C1qBP, Complement Component 1, Q Subcomponent-binding Protein)

Sign In for Pricing
View Details
C1q Receptor, gamma (gC1qR, C1qBP, Complement Component 1, Q Subcomponent-binding Protein)
MBS646522-02 5x 0.1 mg

C1q Receptor, gamma (gC1qR, C1qBP, Complement Component 1, Q Subcomponent-binding Protein)

Sign In for Pricing
View Details
BCCIP (NM_078468) Human Over-expression Lysate
LH13407V 100 µg

BCCIP (NM_078468) Human Over-expression Lysate

Sign In for Pricing
View Details