Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine polyomavirus Minor capsid protein VP2

This Recombinant Murine polyomavirus Minor capsid protein VP2 spans the amino acid sequence from region 2-319.

Product Specifications

Product Name Alternative

Minor capsid protein VP2, Minor structural protein VP2

UniProt

P03097

Expression Region

2-319

Origin

Murine polyomavirus (strain 3) (MPyV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAALTILVDLIEGLAEVSTLTGLSAEAILSGEALAALDGEITALTLEGVMSSETALATMG ISEEVYGFVSTVPVFVNRTAGAIWLMQTVQGASTISLGIQRYLHNEEVPTVNRNMALIPW RDPALLDIYFPGVNQFAHALNVVHDWGHGLLHSVGRYVWQMVVQETQHRLEGAVRELTVR QTHTFLDGLARLLENTRWVVSNAPQSAIDAINRGASSVSSGYSSLSDYYRQLGLNPPQRR ALFNRIEGSMGNGGPTPAAHIQDESGEVIKFYQAPGGAHQRVTPDWMLPLILGLYGDITP TWATVIEEDGPQKKKRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1751 Rabbit Polyclonal Antibody (BF350)
orb2494124 100 µL

KIAA1751 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Rpb1 (phospho Ser1619) Rabbit Polyclonal Antibody
APRab05384-01 20 µL

Rpb1 (phospho Ser1619) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rpb1 (phospho Ser1619) Rabbit Polyclonal Antibody
APRab05384-02 50 µL

Rpb1 (phospho Ser1619) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rpb1 (phospho Ser1619) Rabbit Polyclonal Antibody
APRab05384-03 100 µL

Rpb1 (phospho Ser1619) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rpb1 (phospho Ser1619) Rabbit Polyclonal Antibody
APRab05384-04 200 µL

Rpb1 (phospho Ser1619) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOGAT3 Antibody Blocking Peptide
orb1509882 500 µg

MOGAT3 Antibody Blocking Peptide

Sign In for Pricing
View Details