Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine polyomavirus Minor capsid protein VP2

This Recombinant Murine polyomavirus Minor capsid protein VP2 spans the amino acid sequence from region 2-319.

Product Specifications

Product Name Alternative

Minor capsid protein VP2, Minor structural protein VP2

UniProt

P03096

Expression Region

2-319

Origin

Murine polyomavirus (strain A2) (MPyV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAALTILVDLIEGLAEVSTLTGLSAEAILSGEALAALDGEITALTLEGVMSSETALATMG ISEEVYGFVSTVPVFVSRTAGAIWLMQTVQGASTISLGIQRYLHNEEVPTVNRNMALIPW RDPALLDIYFPGVNQFAHALNVVHDWGHGLLHSVGRYVWQMVVQETQHRLEGAVRELTVR QTHTFLDGLARLLENTRWVVSNAPQSAIDAINRGASSASSGYSSLSDYYRQLGLNPPQRR ALFNRIEGSMGNGGPTPAAHIQDESGEVIKFYQAQVVSHQRVTPDWMLPLILGLYGDITP TWATVIEEDGPQKKKRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HFM1 Antibody
OACA09390-100UG 100 µg

HFM1 Antibody

Sign In for Pricing
View Details
FGF18 AAV Vector (Human) (CMV)
20497101 1 µg

FGF18 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
CLEC4E Protein Vector (Mouse) (pPM-C-HA)
16326024 500 ng

CLEC4E Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CTRP2 Rabbit Monoclonal Antibody
E28G1756 100 µL

CTRP2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MKI67IP ORF Vector (Human) (pORF)
ORF006505 1.0 µg DNA

MKI67IP ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Mouse Membrane progestin receptor beta (Paqr8), partial
MBS7091296 Inquire

Recombinant Mouse Membrane progestin receptor beta (Paqr8), partial

Sign In for Pricing
View Details