Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Pheromone-regulated membrane protein 5 (PRM5)

This Recombinant Saccharomyces cerevisiae Pheromone-regulated membrane protein 5 (PRM5) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Pheromone-regulated membrane protein 5

UniProt

C8ZAC7

Expression Region

1-318

Origin

Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVASSSSSLPLLSNSTSSSIIPSITPPSR NGNPYILDSGDMPNGTVFIVVGGIAGVIFLAILLWWVITTYSSHRLTRSVQDYESKMFSA QHTQFYGDSPYMDYPAKENFQDQVHISESDISPGNKDESVKDALVSHTNNEKPFLSNFER PLSSLVSESNRNSLFISPTGDILYKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVSTIS SSSASSLDNGNEKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNLLVVQSKRK PTPSTYLEHMLEGKEQDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-500 1x 500 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-100 1x 100 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-500 1x 500 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details