Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Magnesium transport protein CorA (corA)

This Recombinant Helicobacter pylori Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

O25901

Expression Region

1-318

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNVFFKQQKFVIKKRFNDFNGFDIEENEVLWFELINPTPNELATLSQEYAIHYNTDHSQ RVSSVTKYWEDSSSVTINAFFTNQDENETFHTEMATFILSNNILFTIYYGTLEIFDSIQK KVLASPKKFEDGFDILTKIFEVYFEKGVECLEWINKQTSLLRKNIIFKETSTHDDILVRL SNLQEFNVTLRDSFFDKRRIITALLRSNKVDSDTKNNLNIILTDFSSLVESTTVNLNSLD NIQNLFASQVNVEQNKIIKLFTVATMAMMPPTLIGTIYGMNFKFMPELEWQYGYLFALIV MAISTILPVIYFKKKGWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (VCAM1/843), CF488A conjugate, 0.1mg/mL
BNC880843-100 1x 100 µL

CD106 / VCAM1 (VCAM1/843), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF568 conjugate, 0.1mg/mL
BNC681484-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (KLK3/801), CF640R conjugate, 0.1mg/mL
BNC400801-100 1x 100 µL

PSA (Prostate Specific Antigen) (KLK3/801), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF594 conjugate, 0.1mg/mL
BNC942026-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details