Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Coiled-coil domain-containing protein 149 (CCDC149)

This Recombinant Bovine Coiled-coil domain-containing protein 149 (CCDC149) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 149

UniProt

Q0VCP9

Expression Region

1-319

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQR LGEVQGDNKLLRMTIAKQRLGDEEIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASV DELQDVKEERSSYQDKVERLNQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVN LLKSNIAKYKNALERRKNSKGQNKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISD LKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGLSYNVSI GFGSMFFLKYLCLWLIAVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Mouse CD127/IL-7RA Flow Cytometry Monoclonal Clone A7R34 APC Ready To Use 200 Tests
IRTAMSCD127A7R34CAPC200 200 Tests

Anti Mouse CD127/IL-7RA Flow Cytometry Monoclonal Clone A7R34 APC Ready To Use 200 Tests

Sign In for Pricing
View Details
Slc6a15 Mouse shRNA Plasmid (Locus ID 103098)
TG505662 1 Kit

Slc6a15 Mouse shRNA Plasmid (Locus ID 103098)

Sign In for Pricing
View Details
MUC12 (Mucin 12, Cell Surface Associated, MUC11) (MaxLight 650)
MBS6228823-01 0.1 mL

MUC12 (Mucin 12, Cell Surface Associated, MUC11) (MaxLight 650)

Sign In for Pricing
View Details
MUC12 (Mucin 12, Cell Surface Associated, MUC11) (MaxLight 650)
MBS6228823-02 5x 0.1 mL

MUC12 (Mucin 12, Cell Surface Associated, MUC11) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Coronavirus 2019 Nucleocapsid (1-419 a.a.)
MBS141693-01 0.1 mg

Recombinant Coronavirus 2019 Nucleocapsid (1-419 a.a.)

Sign In for Pricing
View Details
Recombinant Coronavirus 2019 Nucleocapsid (1-419 a.a.)
MBS141693-02 0.5 mg

Recombinant Coronavirus 2019 Nucleocapsid (1-419 a.a.)

Sign In for Pricing
View Details