Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Coiled-coil domain-containing protein 149 (CCDC149)

This Recombinant Bovine Coiled-coil domain-containing protein 149 (CCDC149) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 149

UniProt

Q0VCP9

Expression Region

1-319

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQR LGEVQGDNKLLRMTIAKQRLGDEEIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASV DELQDVKEERSSYQDKVERLNQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVN LLKSNIAKYKNALERRKNSKGQNKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISD LKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGLSYNVSI GFGSMFFLKYLCLWLIAVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit
YP-W22315-01 48 Tests

Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit
YP-W22315-02 96 Tests

Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human CDH8 shRNA (UAS) - Lentiviral human CDH8 shRNA (UAS, iRFP) (100)
GTR15311634 1 Vial

Lentiviral human CDH8 shRNA (UAS) - Lentiviral human CDH8 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Srpk1 (NM_001025726) Rat Untagged Clone
RN212297 10 µg

Srpk1 (NM_001025726) Rat Untagged Clone

Sign In for Pricing
View Details
C9orf98 (AK8) (NM_152572) Human Over-expression Lysate
E45H14618-2 20 µg

C9orf98 (AK8) (NM_152572) Human Over-expression Lysate

Sign In for Pricing
View Details
TLT2 Monoclonal Antibody
BT-MCA3748-01 50 µL

TLT2 Monoclonal Antibody

Sign In for Pricing
View Details