Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Coiled-coil domain-containing protein 149 (CCDC149)

This Recombinant Bovine Coiled-coil domain-containing protein 149 (CCDC149) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 149

UniProt

Q0VCP9

Expression Region

1-319

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQR LGEVQGDNKLLRMTIAKQRLGDEEIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASV DELQDVKEERSSYQDKVERLNQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVN LLKSNIAKYKNALERRKNSKGQNKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISD LKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGLSYNVSI GFGSMFFLKYLCLWLIAVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Mucin 6 ELISA Kit
MBS086441-01 48 Well

Bovine Mucin 6 ELISA Kit

Sign In for Pricing
View Details
Bovine Mucin 6 ELISA Kit
MBS086441-02 96 Well

Bovine Mucin 6 ELISA Kit

Sign In for Pricing
View Details
Bovine Mucin 6 ELISA Kit
MBS086441-03 5x 96 Well

Bovine Mucin 6 ELISA Kit

Sign In for Pricing
View Details
Bovine Mucin 6 ELISA Kit
MBS086441-04 10x 96 Well

Bovine Mucin 6 ELISA Kit

Sign In for Pricing
View Details
CD11b (C11b/660), CF647 conjugate, 0.1mg/mL
BNC470660-500 1x 500 µL

CD11b (C11b/660), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Mouse CD38 Antibody
JOT22121F 50Tests

PE Anti-Mouse CD38 Antibody

Sign In for Pricing
View Details