Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Estradiol 17-beta-dehydrogenase 12-A (hsd17b12a)

This Recombinant Danio rerio Estradiol 17-beta-dehydrogenase 12-A (hsd17b12a) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Estradiol 17-beta-dehydrogenase 12-A, EC= 1.1.1.62, 17-beta-hydroxysteroid dehydrogenase 12-A, 17-beta-HSD 12-A, zf3.1, zfHSD17B12A

UniProt

Q6P3L6

Expression Region

1-319

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESFNVVETLQPAERALFWVGALITASLALYVVYKTITGFRIWVLGNGDLLSPKLGKWAV VTGATDGIGKSYAEELARRGFSMMLISRSQEKLDDVAKSLESTYKVETKTIAVDFSQIDV YPKIEKGLAGLEIGILVNNVGISYSYPEFFLHIPDLENFITTMINVNITSVCQMTRLVLP RMEARAKGVILNISSASGMFPVPLLTIYSSTKAFVDFFSRGLQTEYKCKGIIIQSVLPFF VATKMTKIRKPTLDKPTPERYVAAELNTVGLQDQTNGYFPHAVMGWVTTILAPIDLVLNL GLRMNKAQRGGYLRRRKLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-100 1x 100 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-500 1x 500 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-100 1x 100 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-100 1x 100 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), CF488A conjugate, 0.1mg/mL
BNC882590-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details