Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Transmembrane protein 231 (TMEM231)

This Recombinant Chicken Transmembrane protein 231 (TMEM231) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Transmembrane protein 231

UniProt

F1NNL1

Expression Region

1-320

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVELFSHPALHTRYRAGLCSAAALALLLIAVLTYVPPLLVAYRSHGFWLKQSAYREQP TVRFRYELLFVATTGPGPGSFLAWSTFPAFNRLQEDRLRVPLLSTREEDKNQDGKMDQLH FKLELPLQPTEHVVGVQLILIFSYQLYRMSTFVMQSMAFLQFFSPVPGSQLYANGDLKLN QRQLLNHCGLDTRYNVSVVNGTSPFASDYDLKNIIAAYRDRNVTTVFSDSNPIWMTGRGA NTPFIVNATIRYPVEVILYQPGFWETIKFAWIQYVSILLIFLWVFGRIKMFVFQNQVFAT TPVSPVLPLSPVLSYKQHQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC38A5 activation kit by CRISPRa
GA114238 1 Kit

Human SLC38A5 activation kit by CRISPRa

Sign In for Pricing
View Details
CD137, Mouse (LOB12), CF568 conjugate, 0.1mg/mL
BNC682012-100 1x 100 µL

CD137, Mouse (LOB12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 840 acid
1401-AAT 1 mg

IFluor® 840 acid

Sign In for Pricing
View Details
C-Oncogene Antibody Sampler Kit
HAK21104 1 Kit

C-Oncogene Antibody Sampler Kit

Sign In for Pricing
View Details
(1-(2,4-dichlorobenzenyl)-1H-imidazole)
TRC-D827560-500MG 500 mg

(1-(2,4-dichlorobenzenyl)-1H-imidazole)

Sign In for Pricing
View Details
Vimentin (Ab-56) Antibody
8B1243-AAT 50 µg

Vimentin (Ab-56) Antibody

Sign In for Pricing
View Details