Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized multiple-sugar transport system permease yteP (yteP)

This Recombinant Uncharacterized multiple-sugar transport system permease yteP (yteP) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Uncharacterized multiple-sugar transport system permease yteP

UniProt

C0SPB3

Expression Region

1-321

Origin

Bacillus subtilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTAEAQAPAVDAVIFKKEKRKRLLIKLIQQKYLYLMILPGCIYFLLFKYVPMWGIVIAF QDYQPFLGILGSEWVGLKHFIRLFTEPTFFLLLKNTLVLFALNLAIFFPVPILLALLLNE VRIALFKKFVQTLIYIPHFMSWVIVVSLSFVLLTVDGGLINELIVFFGGEKINFLLNEEW FRPLYILQVIWREAGWSTIIYLAAITAVDPQLYEAAKMDGAGRLRQMWHITLPAIKSVIV VLLILKIGDTLELGFEHVYLLLNATNREVAEIFDTYVYTAGLKQGQFSYSTAVGVFKAAV GLILVMLANRLAKKFGEEGIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actinin, alpha Antibody, Ready-To-Use
MAB552P 5 mL

Actinin, alpha Antibody, Ready-To-Use

Sign In for Pricing
View Details
AXL Adenovirus (Rat)
12899057 1.0 mL

AXL Adenovirus (Rat)

Sign In for Pricing
View Details
Rno-miR-431 miRNA Inhibitor
orb1868835-01 10 nmol

Rno-miR-431 miRNA Inhibitor

Sign In for Pricing
View Details
Rno-miR-431 miRNA Inhibitor
orb1868835-02 20 nmol

Rno-miR-431 miRNA Inhibitor

Sign In for Pricing
View Details
SRD5A2L Lentiviral Activation Particles (h2)
sc-413197-LAC-2 200 µL

SRD5A2L Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
TREML4 Adenovirus (Human)
47706051 1.0 mL

TREML4 Adenovirus (Human)

Sign In for Pricing
View Details