Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein C18B2.1 (C18B2.1)

This Recombinant Uncharacterized protein C18B2.1 (C18B2.1) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Uncharacterized protein C18B2.1

UniProt

Q18079

Expression Region

1-321

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFAPHTNIMSIARVLIIIASISVICITLFISRPVTRESSIIIAPKTRDMRAEQIRLFALN AMVKANSHTLPPRSKNISAKNLCSRRMTCAPHNRRYETMLKVSPKYKMVNCVVQKSMSTM MTGAMCYLYDEKAYADSGRTFDDEFSTRFCKNKNEFSSVNAVRDAYNISFVKTDWLFSMI TRDPIDRFVSGYVDRCVRISQKNETGQCNGCGLNMTCFIENEYKRLMEISFKRKTHRTME DAHFFPQIWHCDLNEDLEFFEFIQYSNNPETTMMPQLEEMLKRQKVPSDSIRFIKNELLY KKSSHSTTGTPASRFYRSRYS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clec1a (NM_175526) Mouse Tagged ORF Clone
MR203570 10 µg

Clec1a (NM_175526) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HENMT1 Rabbit Polyclonal Antibody
orb587449 100 µL

HENMT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Low Temperature Circulator BCLT-2105
BCLT-2105 1 Unit

Low Temperature Circulator BCLT-2105

Sign In for Pricing
View Details
PLA2G16 (Phospholipase A2, Group XVI, AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-3, MGC118754) (FITC)
MBS6178172-01 0.1 mL

PLA2G16 (Phospholipase A2, Group XVI, AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-3, MGC118754) (FITC)

Sign In for Pricing
View Details
PLA2G16 (Phospholipase A2, Group XVI, AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-3, MGC118754) (FITC)
MBS6178172-02 5x 0.1 mL

PLA2G16 (Phospholipase A2, Group XVI, AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-3, MGC118754) (FITC)

Sign In for Pricing
View Details
Mouse anti-Histone antibody ELISA Kit
ELA-E1150m 96 Tests

Mouse anti-Histone antibody ELISA Kit

Sign In for Pricing
View Details