Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Reticulon-2 (rtn2)

This Recombinant Xenopus tropicalis Reticulon-2 (rtn2) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Reticulon-2

UniProt

Q4FZ58

Expression Region

1-321

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHVLSFTHCKDAPSTASSTPDSCPPEGEEDDSPVTEVNFWPLPSPHEPTFSYITIGSTA PLSRPPVRARRGLGQSRVHAAPREETEEKEVKDVVTYVLLEKTCQLKKLSPPHVQEEVVF VAKPQPQLEVFRAVKDLLYWRDILLSAGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVT LTLRLYTKLLHALKRGNGANPFQYYLDADLKLTTKQAEEITARVLSLLSTTICTLRSLFL VEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHYVSLVSK KGNAFRSKIQGTVKKPPAKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-500 1x 500 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917 + 45M1), CF568 conjugate, 0.1mg/mL
BNC681134-100 1x 100 µL

Mucin 5AC (MUC5AC) (MUC5AC/917 + 45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF405S conjugate, 0.1mg/mL
BNC041602-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details