Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Reticulon-2 (rtn2)

This Recombinant Xenopus laevis Reticulon-2 (rtn2) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Reticulon-2, xRTN2

UniProt

Q4FZ76

Expression Region

1-321

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHVLSFTHCKDAPSTASSTPDSCPLEGEDDDTPVTEVDFWPLPSPHEPTFSYITIGSSA PLSRPPVRARRGLGQGRVHEAPREETEEKEVKDVVNYVLLENTCELKQISPLQVQEEVVF VAKPQPQVEVFRAVKDLLYWRDTLLSTGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVT LTLRLYTKLLHALKRGNGANPFQYYLDTDLKLTTKQAEEIVARAFSLASTTLCTLRSLFL VEELKDSLKFLVIVYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHYVSLVSK KVNAFRSKFQGAAKKPPAKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYAL2 (NM_003773) Human Over-expression Lysate
LC401242 20 µg

HYAL2 (NM_003773) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559588 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) Mouse Monoclonal Antibody [Clone ID: 2B12]
AM06341SU-N 100 µL

alpha 1 Antitrypsin (SERPINA1) Mouse Monoclonal Antibody [Clone ID: 2B12]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126G-01 20 Tests

PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126G-02 100 Tests

PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details